Lineage for d4cqxa1 (4cqx A:1-320)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2047543Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2047955Protein automated matches [190291] (25 species)
    not a true protein
  7. 2048008Species Influenza a virus (a/turkey/turkey/1/2005(h5n1)) [TaxId:375457] [256675] (4 PDB entries)
  8. 2048012Domain d4cqxa1: 4cqx A:1-320 [266066]
    Other proteins in same PDB: d4cqxa2, d4cqxb_, d4cqxd_, d4cqxe2, d4cqxf_
    automated match to d1rd8a_
    complexed with nag, po4; mutant

Details for d4cqxa1

PDB Entry: 4cqx (more details), 2.3 Å

PDB Description: h5 (tyty) del133/ile155thr mutant haemagglutinin in complex with human receptor analogue 6'sln
PDB Compounds: (A:) haemagglutinin ha1

SCOPe Domain Sequences for d4cqxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cqxa1 b.19.1.2 (A:1-320) automated matches {Influenza a virus (a/turkey/turkey/1/2005(h5n1)) [TaxId: 375457]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdeflnvpewsyivekinpandlcypgnfndyeelkhllsrinhfekiqiipks
swsdheasgvssacpyqgrssffrnvvwltkkdnayptikrsynntnqedllvlwgihhp
ndaaeqtrlyqnpttyisvgtstlnqrlvpkiatrskvngqsgrmeffwtilkpndainf
esngnfiapenaykivkkgdstimkseleygncntkcqtpigainssmpfhnihpltige
cpkyvkssrlvlatglrnsp

SCOPe Domain Coordinates for d4cqxa1:

Click to download the PDB-style file with coordinates for d4cqxa1.
(The format of our PDB-style files is described here.)

Timeline for d4cqxa1: