SCOPe 2.01: Domain d5hvpa_: 5hvp A:

Lineage for d5hvpa_ (5hvp A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (5 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (378 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d5hvpa_: 5hvp A: [26605]
   complexed with cl

Details for d5hvpa_

PDB Entry: 5hvp, 2 Å

PDB Description: crystallographic analysis of a complex between human immunodeficiency virus type 1 protease and acetyl-pepstatin at 2.0-angstroms resolution

PDB Compounds: (A:) hiv-1 protease

SCOPe Domain Sequences for d5hvpa_:

Sequence; same for both SEQRES and ATOM records:

>d5hvpa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d5hvpa_:

• d5hvpa_ first appeared (with stable ids) in SCOP 1.55
  
• d5hvpa_ appears in SCOP 1.75
  
• d5hvpa_ appears in SCOPe 2.02
  
• d5hvpa_ appears in the current release, SCOPe 2.08