SCOPe 2.06: Domain d4c1db_: 4c1d B:

Lineage for d4c1db_ (4c1d B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (9 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189349] (34 PDB entries)

8. Domain d4c1db_: 4c1d B: [265970]
   automated match to d4pvob_
   complexed with fmt, na, x8z, zn

Details for d4c1db_

PDB Entry: 4c1d, 1.2 Å

PDB Description: crystal structure of the metallo-beta-lactamase vim-2 with l-captopril

PDB Compounds: (B:) beta-lactamase class b vim-2

SCOPe Domain Sequences for d4c1db_:

Sequence; same for both SEQRES and ATOM records:

>d4c1db_ d.157.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs

Timeline for d4c1db_:

• d4c1db_ first appeared in SCOPe 2.05
  
• d4c1db_ appears in SCOPe 2.07
  
• d4c1db_ appears in the current release, SCOPe 2.08