SCOPe 2.05: Domain d4a19n_: 4a19 N:

Lineage for d4a19n_ (4a19 N:)

1. Root: SCOPe 2.05

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein Eukaryotic, cytoplasmic (60S subunit) [267687] (1 species)

7. Species Tetrahymena thermophila [TaxId:5911] [268006] (2 PDB entries)

8. Domain d4a19n_: 4a19 N: [265889]
   protein/RNA complex; complexed with zn

Details for d4a19n_

PDB Entry: 4a19, 3.52 Å

PDB Description: T.thermophila 60S ribosomal subunit in complex with initiation factor 6. This file contains 26S rRNA and proteins of molecule 2.

PDB Compounds: (N:) rpl27

SCOPe Domain Sequences for d4a19n_:

Sequence; same for both SEQRES and ATOM records:

>d4a19n_ i.1.1.2 (N:) Eukaryotic, cytoplasmic (60S subunit) {Tetrahymena thermophila [TaxId: 5911]}
akflkygrvvillqgrfagkkavivkssedgtkdrkfghvlvagverspkkvtkrmgskk
iqkrtsvkpfikyvnlnhimptrysvkelcdfkelvkedkiknnaksevrdtlkkvfvek
yrtinpeeksashtkfffsklrf

Timeline for d4a19n_:

• d4a19n_ is new in SCOPe 2.05-stable
  
• d4a19n_ appears in SCOPe 2.06
  
• d4a19n_ appears in the current release, SCOPe 2.08