Lineage for d3zixc1 (3zix C:38-199)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252099Fold f.8: Aerolisin/ETX pore-forming domain [56972] (1 superfamily)
    3 domains: (1) alpha+beta; (2&3) all-beta
  4. 2252100Superfamily f.8.1: Aerolisin/ETX pore-forming domain [56973] (3 families) (S)
  5. 2252132Family f.8.1.3: Clostridium perfringens enterotoxin (CPE), pore-forming domain [267612] (2 proteins)
    N-terminal part of Pfam PF03505, PubMed 21489981
  6. 2252136Protein automated matches [267674] (1 species)
    not a true protein
  7. 2252137Species Clostridium perfringens [TaxId:1502] [267811] (3 PDB entries)
  8. 2252146Domain d3zixc1: 3zix C:38-199 [265805]
    Other proteins in same PDB: d3zixa2, d3zixa3, d3zixb2, d3zixb3, d3zixc2, d3zixc3, d3zixd2, d3zixd3, d3zixe2, d3zixe3, d3zixf2, d3zixf3
    automated match to d3am2a2
    complexed with p6g

Details for d3zixc1

PDB Entry: 3zix (more details), 1.9 Å

PDB Description: Clostridium perfringens Enterotoxin with the N-terminal 37 residues deleted
PDB Compounds: (C:) heat-labile enterotoxin b chain

SCOPe Domain Sequences for d3zixc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zixc1 f.8.1.3 (C:38-199) automated matches {Clostridium perfringens [TaxId: 1502]}
sdglyvidkgdgwilgepsvvssqilnpnetgtfsqsltkskevsinvnfsvgftsefiq
asveygfgitigeqntiersvsttagpneyvyykvyatyrkyqairishgnisddgsiyk
ltgiwlsktsadslgnidqgslietgercvltvpstdiekei

SCOPe Domain Coordinates for d3zixc1:

Click to download the PDB-style file with coordinates for d3zixc1.
(The format of our PDB-style files is described here.)

Timeline for d3zixc1: