![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.8: Aerolisin/ETX pore-forming domain [56972] (1 superfamily) 3 domains: (1) alpha+beta; (2&3) all-beta |
![]() | Superfamily f.8.1: Aerolisin/ETX pore-forming domain [56973] (3 families) ![]() |
![]() | Family f.8.1.3: Clostridium perfringens enterotoxin (CPE), pore-forming domain [267612] (2 proteins) N-terminal part of Pfam PF03505, PubMed 21489981 |
![]() | Protein automated matches [267674] (1 species) not a true protein |
![]() | Species Clostridium perfringens [TaxId:1502] [267811] (3 PDB entries) |
![]() | Domain d3zixc1: 3zix C:38-199 [265805] Other proteins in same PDB: d3zixa2, d3zixa3, d3zixb2, d3zixb3, d3zixc2, d3zixc3, d3zixd2, d3zixd3, d3zixe2, d3zixe3, d3zixf2, d3zixf3 automated match to d3am2a2 complexed with p6g |
PDB Entry: 3zix (more details), 1.9 Å
SCOPe Domain Sequences for d3zixc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zixc1 f.8.1.3 (C:38-199) automated matches {Clostridium perfringens [TaxId: 1502]} sdglyvidkgdgwilgepsvvssqilnpnetgtfsqsltkskevsinvnfsvgftsefiq asveygfgitigeqntiersvsttagpneyvyykvyatyrkyqairishgnisddgsiyk ltgiwlsktsadslgnidqgslietgercvltvpstdiekei
Timeline for d3zixc1: