SCOPe 2.06: Domain d3v7ia1: 3v7i A:240-389

Lineage for d3v7ia1 (3v7i A:240-389)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (60 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:1902] [267900] (1 PDB entry)

8. Domain d3v7ia1: 3v7i A:240-389 [265558]
   Other proteins in same PDB: d3v7ia2
   automated match to d1u0ma2

Details for d3v7ia1

PDB Entry: 3v7i, 2.9 Å

PDB Description: germicidin synthase (gcs) from streptomyces coelicolor, a type iii polyketide synthase

PDB Compounds: (A:) putative polyketide synthase

SCOPe Domain Sequences for d3v7ia1:

Sequence; same for both SEQRES and ATOM records:

>d3v7ia1 c.95.1.0 (A:240-389) automated matches {Streptomyces coelicolor [TaxId: 1902]}
pesvlrldaawhhtlpgtrdlhrletradgthfvmdrrgpravqetvtamwewlrvryed
dpsswhpdvllahpggtrvleymeqtmpdewpsgllsysrdsytsgnrggaavfdilrra
hdagqktgsravlyaaapgltatalegewl

Timeline for d3v7ia1:

• d3v7ia1 first appeared in SCOPe 2.05
  
• d3v7ia1 appears in SCOPe 2.07
  
• d3v7ia1 appears in the current release, SCOPe 2.08