Lineage for d3u5cq_ (3u5c Q:)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2268317Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2269098Protein Eukaryotic, cytoplasmic (80S ribosome functional complex) [267636] (5 species)
  7. 2269144Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267998] (4 PDB entries)
    Because SCOP is not case sensitive, we included upper case chains from 3u5c and 3u5e and lower case chains from 3u5g and 3u5i
  8. 2269212Domain d3u5cq_: 3u5c Q: [265447]
    protein/RNA complex; complexed with zn

Details for d3u5cq_

PDB Entry: 3u5c (more details), 3 Å

PDB Description: The structure of the eukaryotic ribosome at 3.0 A resolution. This entry contains proteins of the 40S subunit, ribosome A
PDB Compounds: (Q:) 40S ribosomal protein S16-A

SCOPe Domain Sequences for d3u5cq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u5cq_ i.1.1.1 (Q:) Eukaryotic, cytoplasmic (80S ribosome functional complex) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
avpsvqtfgkkksatavahvkagkglikvngspitlvepeilrfkvyeplllvgldkfsn
idirvrvtggghvsqvyairqaiakglvayhqkyvdeqsknelkkaftsydrtlliadsr
rpepkkfggkgarsrfqksyr

SCOPe Domain Coordinates for d3u5cq_:

Click to download the PDB-style file with coordinates for d3u5cq_.
(The format of our PDB-style files is described here.)

Timeline for d3u5cq_: