Class a: All alpha proteins [46456] (286 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) |
Family a.60.1.0: automated matches [191306] (1 protein) not a true family |
Protein automated matches [190031] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188353] (21 PDB entries) |
Domain d3send1: 3sen D:8-74 [265368] automated match to d3seia1 complexed with k |
PDB Entry: 3sen (more details), 3.1 Å
SCOPe Domain Sequences for d3send1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3send1 a.60.1.0 (D:8-74) automated matches {Human (Homo sapiens) [TaxId: 9606]} ksseavsqwltafqlqlyapnfisagydlptisrmtpedltaigvtkpghrkkiaaeisg lsipdwl
Timeline for d3send1: