![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
![]() | Family a.60.1.0: automated matches [191306] (1 protein) not a true family |
![]() | Protein automated matches [190031] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries) |
![]() | Domain d3sena2: 3sen A:75-149 [265363] automated match to d3seia2 complexed with k |
PDB Entry: 3sen (more details), 3.1 Å
SCOPe Domain Sequences for d3sena2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sena2 a.60.1.0 (A:75-149) automated matches {Human (Homo sapiens) [TaxId: 9606]} pehkpanlavwlsmiglaqyykvlvdngyenidfitditwedlqeigitklghqkklmla vrklaelqkaeyaky
Timeline for d3sena2: