Lineage for d3r0qe_ (3r0q E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2895050Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267876] (1 PDB entry)
  8. 2895053Domain d3r0qe_: 3r0q E: [265274]
    automated match to d4qppa_
    complexed with sah

Details for d3r0qe_

PDB Entry: 3r0q (more details), 2.61 Å

PDB Description: A Uniquely Open Conformation Revealed in the Crystal Structure of Arabidopsis Thaliana Protein Arginine Methyltransferase 10
PDB Compounds: (E:) Probable protein arginine N-methyltransferase 4.2

SCOPe Domain Sequences for d3r0qe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r0qe_ c.66.1.0 (E:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
yfctysflyhqkdmlsdrvrmdayfnavfqnkhhfegktvldvgtgsgilaiwsaqagar
kvyaveatkmadharalvkannldhiveviegsvedislpekvdviisewmgyfllresm
fdsvisardrwlkptgvmypsharmwlapiksniadrkrndfdgamadwhnfsdeiksyy
gvdmgvltkpfaeeqekyyiqtamwndlnpqqiigtptivkemdcltasvseieevrsnv
tsvinmehtrlcgfggwfdvqfsgrkedpaqqeielttapseqhcthwgqqvfimsnpin
veegdnlnlgllmsrskenhrlmeielnceikeasgnpkesfkktyfie

SCOPe Domain Coordinates for d3r0qe_:

Click to download the PDB-style file with coordinates for d3r0qe_.
(The format of our PDB-style files is described here.)

Timeline for d3r0qe_: