Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Chromohalobacter salexigens [TaxId:158080] [267864] (6 PDB entries) |
Domain d3qkef1: 3qke F:4-113 [265262] Other proteins in same PDB: d3qkea2, d3qkea3, d3qkeb2, d3qkeb3, d3qkec2, d3qkec3, d3qked2, d3qked3, d3qkee2, d3qkee3, d3qkef2, d3qkef3, d3qkeg2, d3qkeg3, d3qkeh2, d3qkeh3 automated match to d4il2a1 complexed with gco, mg |
PDB Entry: 3qke (more details), 1.55 Å
SCOPe Domain Sequences for d3qkef1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qkef1 d.54.1.0 (F:4-113) automated matches {Chromohalobacter salexigens [TaxId: 158080]} kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg
Timeline for d3qkef1: