Lineage for d3qked1 (3qke D:4-113)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554768Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2554769Protein automated matches [226922] (94 species)
    not a true protein
  7. 2554950Species Chromohalobacter salexigens [TaxId:158080] [267864] (6 PDB entries)
  8. 2554954Domain d3qked1: 3qke D:4-113 [265258]
    Other proteins in same PDB: d3qkea2, d3qkea3, d3qkeb2, d3qkeb3, d3qkec2, d3qkec3, d3qked2, d3qked3, d3qkee2, d3qkee3, d3qkef2, d3qkef3, d3qkeg2, d3qkeg3, d3qkeh2, d3qkeh3
    automated match to d4il2a1
    complexed with gco, mg

Details for d3qked1

PDB Entry: 3qke (more details), 1.55 Å

PDB Description: crystal structure of d-mannonate dehydratase from chromohalobacter salexigens complexed with mg and d-gluconate
PDB Compounds: (D:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3qked1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qked1 d.54.1.0 (D:4-113) automated matches {Chromohalobacter salexigens [TaxId: 158080]}
kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag
riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

SCOPe Domain Coordinates for d3qked1:

Click to download the PDB-style file with coordinates for d3qked1.
(The format of our PDB-style files is described here.)

Timeline for d3qked1: