SCOPe 2.07: Domain d3obta1: 3obt A:863-1067

Lineage for d3obta1 (3obt A:863-1067)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries)

8. Domain d3obta1: 3obt A:863-1067 [265112]
   Other proteins in same PDB: d3obta2, d3obta3, d3obta4
   automated match to d3n7ja1
   complexed with gol, slb

Details for d3obta1

PDB Entry: 3obt, 2 Å

PDB Description: crystal structure of botulinum neurotoxin serotype d ligand binding domain in complex with n-acetylneuraminic acid

PDB Compounds: (A:) Botulinum neurotoxin type D

SCOPe Domain Sequences for d3obta1:

Sequence, based on SEQRES records:

>d3obta1 b.29.1.0 (A:863-1067) automated matches {Clostridium botulinum [TaxId: 1491]}
sindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnni
lysaiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrky
kslifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldktiv
fgidenidenqmlwirdfnifskel

Sequence, based on observed residues (ATOM records):

>d3obta1 b.29.1.0 (A:863-1067) automated matches {Clostridium botulinum [TaxId: 1491]}
sindskilslqnkknalvdtsgynaevrvgdnvqlntiytndfklsssgdkiivnlnnns
aiyenssvsfwikiskdltnshneytiinsieqnsgwklcirngniewilqdvnrkyksl
ifdyseslshtgytnkwffvtitnnimgymklyingelkqsqkiedldevkldktivfgi
denidenqmlwirdfnifskel

Timeline for d3obta1:

• d3obta1 first appeared in SCOPe 2.05
  
• d3obta1 appears in SCOPe 2.06
  
• d3obta1 appears in the current release, SCOPe 2.08