SCOPe 2.06: Domain d3kg2a2: 3kg2 A:389-507,A:633-773

Lineage for d3kg2a2 (3kg2 A:389-507,A:633-773)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (134 PDB entries)

8. Domain d3kg2a2: 3kg2 A:389-507,A:633-773 [264975]
   Other proteins in same PDB: d3kg2a1, d3kg2a3, d3kg2b1, d3kg2b3, d3kg2c1, d3kg2c3, d3kg2d1, d3kg2d3
   protein/RNA complex; complexed with zk1

Details for d3kg2a2

PDB Entry: 3kg2, 3.6 Å

PDB Description: ampa subtype ionotropic glutamate receptor in complex with competitive antagonist zk 200775

PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d3kg2a2:

Sequence; same for both SEQRES and ATOM records:

>d3kg2a2 c.94.1.1 (A:389-507,A:633-773) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
gleqktvvvttilespyvmmkanhaalagneryegycvdlaaeiakhcgfkykltivgdg
kygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkpX
iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlk
lseqglldklknkwwydkgec

Timeline for d3kg2a2:

• d3kg2a2 first appeared in SCOPe 2.05
  
• d3kg2a2 appears in SCOPe 2.07
  
• d3kg2a2 appears in the current release, SCOPe 2.08