Class b: All beta proteins [48724] (176 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) the barrel is decorated with additional structures |
Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins) barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel |
Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [50627] (1 PDB entry) |
Domain d7odca1: 7odc A:2-43,A:284-418 [26488] Other proteins in same PDB: d7odca2 complexed with plp |
PDB Entry: 7odc (more details), 1.6 Å
SCOPe Domain Sequences for d7odca1:
Sequence, based on SEQRES records: (download)
>d7odca1 b.49.2.3 (A:2-43,A:284-418) Eukaryotic ornithine decarboxylase (ODC) {Mouse (Mus musculus) [TaxId: 10090]} ssftkdefdchildegftakdildqkinevsssddkdafyvaXftlavniiakktvwkeq pgsddedesneqtfmyyvndgvygsfncilydhahvkallqkrpkpdekyysssiwgptc dgldrivercnlpemhvgdwmlfenmgaytvaaastfngfqrpniyyvmsrpmwqlmk
>d7odca1 b.49.2.3 (A:2-43,A:284-418) Eukaryotic ornithine decarboxylase (ODC) {Mouse (Mus musculus) [TaxId: 10090]} ssftkdefdchildegftakdildqkindkdafyvaXftlavniiakktvweqtfmyyvn dgvygsfncilydhahvkallqkrpkpdekyysssiwgptcdgldrivercnlpemhvgd wmlfenmgaytvaaastfngfqrpniyyvmsrpmwqlmk
Timeline for d7odca1: