Lineage for d7odca1 (7odc A:2-43,A:284-418)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1547881Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 1548097Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 1548125Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
    barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel
  6. 1548142Protein Eukaryotic ornithine decarboxylase (ODC) [50625] (3 species)
  7. 1548146Species Mouse (Mus musculus) [TaxId:10090] [50627] (1 PDB entry)
  8. 1548147Domain d7odca1: 7odc A:2-43,A:284-418 [26488]
    Other proteins in same PDB: d7odca2
    complexed with plp

Details for d7odca1

PDB Entry: 7odc (more details), 1.6 Å

PDB Description: crystal structure ornithine decarboxylase from mouse, truncated 37 residues from the c-terminus, to 1.6 angstrom resolution
PDB Compounds: (A:) protein (ornithine decarboxylase)

SCOPe Domain Sequences for d7odca1:

Sequence, based on SEQRES records: (download)

>d7odca1 b.49.2.3 (A:2-43,A:284-418) Eukaryotic ornithine decarboxylase (ODC) {Mouse (Mus musculus) [TaxId: 10090]}
ssftkdefdchildegftakdildqkinevsssddkdafyvaXftlavniiakktvwkeq
pgsddedesneqtfmyyvndgvygsfncilydhahvkallqkrpkpdekyysssiwgptc
dgldrivercnlpemhvgdwmlfenmgaytvaaastfngfqrpniyyvmsrpmwqlmk

Sequence, based on observed residues (ATOM records): (download)

>d7odca1 b.49.2.3 (A:2-43,A:284-418) Eukaryotic ornithine decarboxylase (ODC) {Mouse (Mus musculus) [TaxId: 10090]}
ssftkdefdchildegftakdildqkindkdafyvaXftlavniiakktvweqtfmyyvn
dgvygsfncilydhahvkallqkrpkpdekyysssiwgptcdgldrivercnlpemhvgd
wmlfenmgaytvaaastfngfqrpniyyvmsrpmwqlmk

SCOPe Domain Coordinates for d7odca1:

Click to download the PDB-style file with coordinates for d7odca1.
(The format of our PDB-style files is described here.)

Timeline for d7odca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7odca2