Lineage for d3bsma1 (3bsm A:4-113)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948105Species Chromohalobacter salexigens [TaxId:290398] [232962] (8 PDB entries)
  8. 2948143Domain d3bsma1: 3bsm A:4-113 [264706]
    Other proteins in same PDB: d3bsma2, d3bsma3, d3bsmb2, d3bsmb3, d3bsmc2, d3bsmc3, d3bsmd2, d3bsmd3
    automated match to d4il2a1

Details for d3bsma1

PDB Entry: 3bsm (more details), 2.2 Å

PDB Description: crystal structure of d-mannonate dehydratase from chromohalobacter salexigens
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3bsma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bsma1 d.54.1.0 (A:4-113) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
kirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrdag
riedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllgg

SCOPe Domain Coordinates for d3bsma1:

Click to download the PDB-style file with coordinates for d3bsma1.
(The format of our PDB-style files is described here.)

Timeline for d3bsma1: