Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.0: automated matches [191471] (1 protein) not a true family |
Protein automated matches [190746] (16 species) not a true protein |
Species Escherichia coli [TaxId:562] [267777] (1 PDB entry) |
Domain d2g6va1: 2g6v A:2-146 [264288] Other proteins in same PDB: d2g6va2, d2g6va3, d2g6vb2, d2g6vb3 automated match to d2b3za2 |
PDB Entry: 2g6v (more details), 2.6 Å
SCOPe Domain Sequences for d2g6va1:
Sequence, based on SEQRES records: (download)
>d2g6va1 c.97.1.0 (A:2-146) automated matches {Escherichia coli [TaxId: 562]} qdeyymaralklaqrgrftthpnpnvgcvivkdgeivgegyhqragephaevhalrmage kakgatayvtlepcshhgrtppccdaliaagvarvvasmqdpnpqvagrglyrlqqagid vshglmmseaeqlnkgflkrmrtgf
>d2g6va1 c.97.1.0 (A:2-146) automated matches {Escherichia coli [TaxId: 562]} qdeyymaralklaqrgrftthpnpnvgcvivkdgeivgegyhqragephaevhalrmage kakgatayvtlepcpccdaliaagvarvvasmqdpnpqvagrglyrlqqagidvshglmm seaeqlnkgflkrmrtgf
Timeline for d2g6va1: