SCOPe 2.08: Domain d2g6va1: 2g6v A:2-146

Lineage for d2g6va1 (2g6v A:2-146)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.0: automated matches [191471] (1 protein)
   not a true family

6. Protein automated matches [190746] (16 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [267777] (1 PDB entry)

8. Domain d2g6va1: 2g6v A:2-146 [264288]
   Other proteins in same PDB: d2g6va2, d2g6va3, d2g6vb2, d2g6vb3
   automated match to d2b3za2

Details for d2g6va1

PDB Entry: 2g6v, 2.6 Å

PDB Description: The crystal structure of ribD from Escherichia coli

PDB Compounds: (A:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2g6va1:

Sequence, based on SEQRES records:

>d2g6va1 c.97.1.0 (A:2-146) automated matches {Escherichia coli [TaxId: 562]}
qdeyymaralklaqrgrftthpnpnvgcvivkdgeivgegyhqragephaevhalrmage
kakgatayvtlepcshhgrtppccdaliaagvarvvasmqdpnpqvagrglyrlqqagid
vshglmmseaeqlnkgflkrmrtgf

Sequence, based on observed residues (ATOM records):

>d2g6va1 c.97.1.0 (A:2-146) automated matches {Escherichia coli [TaxId: 562]}
qdeyymaralklaqrgrftthpnpnvgcvivkdgeivgegyhqragephaevhalrmage
kakgatayvtlepcpccdaliaagvarvvasmqdpnpqvagrglyrlqqagidvshglmm
seaeqlnkgflkrmrtgf

Timeline for d2g6va1:

• d2g6va1 first appeared in SCOPe 2.05
  
• d2g6va1 appears in SCOPe 2.07