Lineage for d2edla1 (2edl A:8-104)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2034419Domain d2edla1: 2edl A:8-104 [264272]
    Other proteins in same PDB: d2edla2, d2edla3
    automated match to d2edfa_

Details for d2edla1

PDB Entry: 2edl (more details)

PDB Description: solution structure of the ig-like domain (3801-3897) of human obscurin
PDB Compounds: (A:) Obscurin

SCOPe Domain Sequences for d2edla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2edla1 b.1.1.0 (A:8-104) automated matches {Human (Homo sapiens) [TaxId: 9606]}
parfiedvknqearegatavlqcelskaapvewrkgsetlrggdryslrqdgtrcelqih
glsvadtgeyscvcgqertsatltvralparftqdlk

SCOPe Domain Coordinates for d2edla1:

Click to download the PDB-style file with coordinates for d2edla1.
(The format of our PDB-style files is described here.)

Timeline for d2edla1: