SCOPe 2.05: Domain d1x66a_: 1x66 A:

Lineage for d1x66a_ (1x66 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (21 PDB entries)

8. Domain d1x66a_: 1x66 A: [264211]
   automated match to d2dkxa_

Details for d1x66a_

PDB Entry: 1x66

PDB Description: solution structure of the sam_pnt-domain of the human friend leukemiaintegration 1 transcription factor

PDB Compounds: (A:) Friend leukemia integration 1 transcription factor

SCOPe Domain Sequences for d1x66a_:

Sequence; same for both SEQRES and ATOM records:

>d1x66a_ a.60.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgppnmttnerrvivpadptlwtqehvrqwlewaikeyslmeidtsffqnmdgke
lckmnkedflrattlyntevllshlsylresssgpssg

Timeline for d1x66a_:

• d1x66a_ is new in SCOPe 2.05-stable
  
• d1x66a_ is called d1x66a1 in SCOPe 2.06
  
• d1x66a_ appears in the current release, SCOPe 2.08, called d1x66a1