SCOPe 2.06: Domain d4uygf_: 4uyg F:

Lineage for d4uygf_ (4uyg F:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries)

8. Domain d4uygf_: 4uyg F: [264011]
   automated match to d4a9ib_
   complexed with 73b, so4

Details for d4uygf_

PDB Entry: 4uyg, 2.5 Å

PDB Description: C-Terminal bromodomain of Human BRD2 with I-BET726 (GSK1324726A)

PDB Compounds: (F:) Bromodomain-containing protein 2

SCOPe Domain Sequences for d4uygf_:

Sequence; same for both SEQRES and ATOM records:

>d4uygf_ a.29.2.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lseqlkhcngilkellskkhaayawpfykpvdasalglhdyhdiikhpmdlstvkrkmen
rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd

Timeline for d4uygf_:

• d4uygf_ first appeared in SCOPe 2.05
  
• d4uygf_ appears in SCOPe 2.07
  
• d4uygf_ appears in the current release, SCOPe 2.08