![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) ![]() Pfam PF06596 |
![]() | Family f.23.40.1: PsbX-like [267615] (2 proteins) |
![]() | Protein automated matches [267680] (2 species) not a true protein |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (26 PDB entries) |
![]() | Domain d4ub6x_: 4ub6 X: [263956] Other proteins in same PDB: d4ub6a_, d4ub6b_, d4ub6c_, d4ub6d_, d4ub6e_, d4ub6f_, d4ub6h_, d4ub6i_, d4ub6j_, d4ub6k_, d4ub6l_, d4ub6m_, d4ub6o_, d4ub6t_, d4ub6u_, d4ub6v_, d4ub6z_ automated match to d3a0hx_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 4ub6 (more details), 1.95 Å
SCOPe Domain Sequences for d4ub6x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ub6x_ f.23.40.1 (X:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} titpslkgffigllsgavvlgltfavliaisqidkvqrs
Timeline for d4ub6x_: