Lineage for d4ub6o_ (4ub6 O:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2627486Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2627487Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 2627529Family f.4.1.4: PsbO-like [161115] (2 proteins)
    Pfam PF01716; MSP
  6. 2627530Protein Manganese-stabilising protein, PsbO [161116] (2 species)
  7. 2627533Species Thermosynechococcus vulcanus [TaxId:32053] [189919] (27 PDB entries)
  8. 2627543Domain d4ub6o_: 4ub6 O: [261425]
    Other proteins in same PDB: d4ub6a_, d4ub6b_, d4ub6c_, d4ub6d_, d4ub6e_, d4ub6f_, d4ub6h_, d4ub6i_, d4ub6j_, d4ub6k_, d4ub6l_, d4ub6m_, d4ub6t_, d4ub6u_, d4ub6v_, d4ub6x_, d4ub6z_
    automated match to d4il6o_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d4ub6o_

PDB Entry: 4ub6 (more details), 1.95 Å

PDB Description: native structure of photosystem ii (dataset-1) by a femtosecond x-ray laser
PDB Compounds: (O:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d4ub6o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ub6o_ f.4.1.4 (O:) Manganese-stabilising protein, PsbO {Thermosynechococcus vulcanus [TaxId: 32053]}
tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
epa

SCOPe Domain Coordinates for d4ub6o_:

Click to download the PDB-style file with coordinates for d4ub6o_.
(The format of our PDB-style files is described here.)

Timeline for d4ub6o_: