SCOP 1.73: Domain d1vcpa_: 1vcp A:

Lineage for d1vcpa_ (1vcp A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (4 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein Viral capsid protein [50597] (3 species)

7. Species Semliki forest virus [TaxId:11033] [50599] (2 PDB entries)

8. Domain d1vcpa_: 1vcp A: [26395]

Details for d1vcpa_

PDB Entry: 1vcp, 3 Å

PDB Description: semliki forest virus capsid protein (crystal form i)

PDB Compounds: (A:) semliki forest virus capsid protein

SCOP Domain Sequences for d1vcpa_:

Sequence; same for both SEQRES and ATOM records:

>d1vcpa_ b.47.1.3 (A:) Viral capsid protein {Semliki forest virus [TaxId: 11033]}
cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
negsrtalsvvtwnkdmvtrvtpegseew

Timeline for d1vcpa_:

• d1vcpa_ first appeared (with stable ids) in SCOP 1.55
  
• d1vcpa_ appears in SCOP 1.71
  
• d1vcpa_ appears in SCOP 1.75
  
• d1vcpa_ appears in the current release, SCOPe 2.08