Lineage for d1vcpa_ (1vcp A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 15540Family b.47.1.3: Viral proteases [50596] (2 proteins)
  6. 15566Protein Viral capsid protein [50597] (2 species)
  7. 15567Species Semliki forest virus [TaxId:11033] [50599] (2 PDB entries)
  8. 15568Domain d1vcpa_: 1vcp A: [26395]

Details for d1vcpa_

PDB Entry: 1vcp (more details), 3 Å

PDB Description: semliki forest virus capsid protein (crystal form i)

SCOP Domain Sequences for d1vcpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcpa_ b.47.1.3 (A:) Viral capsid protein {Semliki forest virus}
cifevkhegkvtgyaclvgdkvmkpahvkgvidnadlaklafkksskydlecaqipvhmr
sdaskythekpeghynwhhgavqysggrftiptgagkpgdsgrpifdnkgrvvaivlgga
negsrtalsvvtwnkdmvtrvtpegseew

SCOP Domain Coordinates for d1vcpa_:

Click to download the PDB-style file with coordinates for d1vcpa_.
(The format of our PDB-style files is described here.)

Timeline for d1vcpa_: