SCOPe 2.05: Domain d4tkvc_: 4tkv C:

Lineage for d4tkvc_ (4tkv C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.3: Nitrogenase iron-molybdenum protein [53816] (3 proteins)
   contains three domains of this fold; "Helical backbone" holds domains 2 and 3
   both chains are homologous; the inter-chain arrangement of domains 1 is similar to the intra-chain arrangement of domains 2 and 3
   automatically mapped to Pfam PF00148

6. Protein automated matches [190199] (2 species)
   not a true protein

7. Species Azotobacter vinelandii [TaxId:354] [186943] (13 PDB entries)

8. Domain d4tkvc_: 4tkv C: [263900]
   Other proteins in same PDB: d4tkvb_, d4tkvd_
   automated match to d1m34a_
   complexed with clf, cmo, fe2, hca, ice, imd

Details for d4tkvc_

PDB Entry: 4tkv, 1.5 Å

PDB Description: co-bound nitrogenase mofe-protein from a. vinelandii

PDB Compounds: (C:) nitrogenase molybdenum-iron protein alpha chain

SCOPe Domain Sequences for d4tkvc_:

Sequence; same for both SEQRES and ATOM records:

>d4tkvc_ c.92.2.3 (C:) automated matches {Azotobacter vinelandii [TaxId: 354]}
msreevesliqevlevypekarkdrnkhlavndpavtqskkciisnkksqpglmtirgca
yagskgvvwgpikdmihishgpvgcgqysragrrnyyigttgvnafvtmnftsdfqekdi
vfggdkklaklidevetlfplnkgisvqsecpigligddiesvskvkgaelsktivpvrc
egfrgvsqslghhiandavrdwvlgkrdedttfastpydvaiigdyniggdawssrille
emglrcvaqwsgdgsiseieltpkvklnlvhcyrsmnyisrhmeekygipwmeynffgpt
ktieslraiaakfdesiqkkceeviakykpeweavvakyrprlegkrvmlyigglrprhv
igayedlgmevvgtgyefahnddydrtmkemgdstllyddvtgyefeefvkrikpdligs
gikekfifqkmgipfrqmhswdysgpyhgfdgfaifardmdmtlnnpcwkklqapwe

Timeline for d4tkvc_:

• d4tkvc_ is new in SCOPe 2.05-stable
  
• d4tkvc_ appears in SCOPe 2.06
  
• d4tkvc_ appears in the current release, SCOPe 2.08