SCOPe 2.05: Domain d4rgbb_: 4rgb B:

Lineage for d4rgbb_ (4rgb B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Mycobacterium avium [TaxId:243243] [189589] (5 PDB entries)

8. Domain d4rgbb_: 4rgb B: [263865]
   automated match to d3o38c_
   complexed with nad

Details for d4rgbb_

PDB Entry: 4rgb, 1.95 Å

PDB Description: crystal structure of a putative carveol dehydrogenase from mycobacterium avium bound to nad

PDB Compounds: (B:) carveol dehydrogenase

SCOPe Domain Sequences for d4rgbb_:

Sequence; same for both SEQRES and ATOM records:

>d4rgbb_ c.2.1.0 (B:) automated matches {Mycobacterium avium [TaxId: 243243]}
gsldgrvvfitgaargqgrshavmcaeqganivgvdicedidivpyklgtyeeleetarl
vektgqemlfrkadvrdkavlqevfdagveqfghidtvianagvvltnpderdasealrl
gldimligvwntfqvaiphmkergqggnliatssmialldltdgrggtdayltsklaitg
lvrsyalmlaadrirvngvaptncstpmitenpalfkvieenphlvnamstalpdfpmie
prdvsnailflisdagrsftgsvlkvdagmdvkr

Timeline for d4rgbb_:

• d4rgbb_ is new in SCOPe 2.05-stable
  
• d4rgbb_ appears in SCOPe 2.06
  
• d4rgbb_ appears in the current release, SCOPe 2.08