Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Mycobacterium avium [TaxId:243243] [189589] (5 PDB entries) |
Domain d4rgbb_: 4rgb B: [263865] automated match to d3o38c_ complexed with nad |
PDB Entry: 4rgb (more details), 1.95 Å
SCOPe Domain Sequences for d4rgbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rgbb_ c.2.1.0 (B:) automated matches {Mycobacterium avium [TaxId: 243243]} gsldgrvvfitgaargqgrshavmcaeqganivgvdicedidivpyklgtyeeleetarl vektgqemlfrkadvrdkavlqevfdagveqfghidtvianagvvltnpderdasealrl gldimligvwntfqvaiphmkergqggnliatssmialldltdgrggtdayltsklaitg lvrsyalmlaadrirvngvaptncstpmitenpalfkvieenphlvnamstalpdfpmie prdvsnailflisdagrsftgsvlkvdagmdvkr
Timeline for d4rgbb_: