Lineage for d1kxf__ (1kxf -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 61083Family b.47.1.3: Viral proteases [50596] (2 proteins)
  6. 61109Protein Viral capsid protein [50597] (2 species)
  7. 61116Species Sindbis virus [TaxId:11034] [50598] (10 PDB entries)
  8. 61123Domain d1kxf__: 1kxf - [26380]

Details for d1kxf__

PDB Entry: 1kxf (more details), 2.38 Å

PDB Description: sindbis virus capsid, (wild-type) residues 1-264, tetragonal crystal form (form ii)

SCOP Domain Sequences for d1kxf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxf__ b.47.1.3 (-) Viral capsid protein {Sindbis virus}
malkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydme
faqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgr
vvaivlggadegtrtalsvvtwnskgktikttpegteew

SCOP Domain Coordinates for d1kxf__:

Click to download the PDB-style file with coordinates for d1kxf__.
(The format of our PDB-style files is described here.)

Timeline for d1kxf__: