Lineage for d1kxf__ (1kxf -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.3: Viral proteases [50596] (2 proteins) Protein Viral capsid protein [50597] (2 species) Species Sindbis virus [TaxId:11034] [50598] (10 PDB entries) 
Domain d1kxf__: 1kxf - [26380]
Details for d1kxf__
PDB Entry: 1kxf (more details), 2.38 Å
PDB Description: sindbis virus capsid, (wild-type) residues 1-264, tetragonal crystal form (form ii)
SCOP Domain Sequences for d1kxf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kxf__ b.47.1.3 (-) Viral capsid protein {Sindbis virus}
malkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydme
faqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgr
vvaivlggadegtrtalsvvtwnskgktikttpegteew
SCOP Domain Coordinates for d1kxf__:
Click to download the PDB-style file with coordinates for d1kxf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kxf__:
- d1kxf__ appears in SCOP 1.57
- d1kxf__ appears in the current release, SCOPe 2.08, called d1kxfa_
View in 3D