Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Beta-acrosin [50593] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [50595] (1 PDB entry) |
Domain d1fiz.1: 1fiz L:,A: [26379] complexed with pbz, so4 |
PDB Entry: 1fiz (more details), 2.9 Å
SCOPe Domain Sequences for d1fiz.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1fiz.1 b.47.1.2 (L:,A:) Beta-acrosin {Pig (Sus scrofa) [TaxId: 9823]} atcdgpcglrfrqXvvggmsaepgawpwmvslqifmyhnnrryhtcggillnshwvltaa hcfknkkkvtdwrlifganevvwgsnkpvkpplqerfveeiiihekyvsgleindialik itppvpcgpfigpgclpqfkagpprapqtcwvtgwgylkekgprtsptlqearvalidle lcnstrwyngrirstnvcagyprgkidtcqgdsggplmcrdraentfvvvgitswgvgca rakrpgvytstwpylnwiaskigsnalqmvqlgtppr
Timeline for d1fiz.1: