Lineage for d1fiz.1 (1fiz L:,A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 953281Protein Beta-acrosin [50593] (2 species)
  7. 953282Species Pig (Sus scrofa) [TaxId:9823] [50595] (1 PDB entry)
  8. 953283Domain d1fiz.1: 1fiz L:,A: [26379]
    complexed with pbz, so4

Details for d1fiz.1

PDB Entry: 1fiz (more details), 2.9 Å

PDB Description: three dimensional structure of beta-acrosin from boar spermatozoa
PDB Compounds: (A:) beta-acrosin heavy chain, (L:) beta-acrosin light chain

SCOPe Domain Sequences for d1fiz.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1fiz.1 b.47.1.2 (L:,A:) Beta-acrosin {Pig (Sus scrofa) [TaxId: 9823]}
atcdgpcglrfrqXvvggmsaepgawpwmvslqifmyhnnrryhtcggillnshwvltaa
hcfknkkkvtdwrlifganevvwgsnkpvkpplqerfveeiiihekyvsgleindialik
itppvpcgpfigpgclpqfkagpprapqtcwvtgwgylkekgprtsptlqearvalidle
lcnstrwyngrirstnvcagyprgkidtcqgdsggplmcrdraentfvvvgitswgvgca
rakrpgvytstwpylnwiaskigsnalqmvqlgtppr

SCOPe Domain Coordinates for d1fiz.1:

Click to download the PDB-style file with coordinates for d1fiz.1.
(The format of our PDB-style files is described here.)

Timeline for d1fiz.1: