Lineage for d1ddjb_ (1ddj B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1127558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1127559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1127765Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1128353Protein Plasmin(ogen), catalytic domain [50588] (1 species)
  7. 1128354Species Human (Homo sapiens) [TaxId:9606] [50589] (8 PDB entries)
  8. 1128356Domain d1ddjb_: 1ddj B: [26363]

Details for d1ddjb_

PDB Entry: 1ddj (more details), 2 Å

PDB Description: crystal structure of human plasminogen catalytic domain
PDB Compounds: (B:) plasminogen

SCOPe Domain Sequences for d1ddjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddjb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
sfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaahc
leksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvip
aclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqste
lcaghlaggtdscqgdaggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtwi
egvmrnn

SCOPe Domain Coordinates for d1ddjb_:

Click to download the PDB-style file with coordinates for d1ddjb_.
(The format of our PDB-style files is described here.)

Timeline for d1ddjb_: