Lineage for d4puoa2 (4puo A:430-554)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2139124Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2140276Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2140277Protein automated matches [190396] (35 species)
    not a true protein
  7. 2140432Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (19 PDB entries)
  8. 2140450Domain d4puoa2: 4puo A:430-554 [263570]
    Other proteins in same PDB: d4puoa1, d4puoa3, d4puob_, d4puoc1, d4puoc3, d4puod_
    automated match to d2ykna2
    protein/DNA complex; protein/RNA complex; complexed with nvp

Details for d4puoa2

PDB Entry: 4puo (more details), 2.9 Å

PDB Description: Crystal structure of HIV-1 reverse transcriptase in complex with RNA/DNA and Nevirapine
PDB Compounds: (A:) HIV-1 reverse transcriptase, p66 subunit

SCOPe Domain Sequences for d4puoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4puoa2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtnsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

SCOPe Domain Coordinates for d4puoa2:

Click to download the PDB-style file with coordinates for d4puoa2.
(The format of our PDB-style files is described here.)

Timeline for d4puoa2: