Lineage for d1fxya_ (1fxy A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 953446Protein Coagulation factor Xa-trypsin chimera [50577] (1 species)
  7. 953447Species Synthetic, based on Homo sapiens sequence [50578] (1 PDB entry)
    Xa: residues 16-121; trypsin: residues 122-246
  8. 953448Domain d1fxya_: 1fxy A: [26347]
    complexed with 0g6

Details for d1fxya_

PDB Entry: 1fxy (more details), 2.15 Å

PDB Description: coagulation factor xa-trypsin chimera inhibited with d-phe-pro-arg-chloromethylketone
PDB Compounds: (A:) coagulation factor xa-trypsin chimera

SCOPe Domain Sequences for d1fxya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence}
ivggynckdgevpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte
qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaslptappatgtkc
lisgwgntassgadypdelqcldapvlsqakceasypgkitsnmfcvgfleggkdscqgd
sggpvvcngqlqgvvswgdgcaqknkpgvytkvynyvkwikntiaans

SCOPe Domain Coordinates for d1fxya_:

Click to download the PDB-style file with coordinates for d1fxya_.
(The format of our PDB-style files is described here.)

Timeline for d1fxya_: