Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Coagulation factor Xa-trypsin chimera [50577] (1 species) |
Species Synthetic, based on Homo sapiens sequence [50578] (1 PDB entry) Xa: residues 16-121; trypsin: residues 122-246 |
Domain d1fxya_: 1fxy A: [26347] complexed with 0g6 |
PDB Entry: 1fxy (more details), 2.15 Å
SCOPe Domain Sequences for d1fxya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} ivggynckdgevpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaslptappatgtkc lisgwgntassgadypdelqcldapvlsqakceasypgkitsnmfcvgfleggkdscqgd sggpvvcngqlqgvvswgdgcaqknkpgvytkvynyvkwikntiaans
Timeline for d1fxya_: