SCOP 1.67: Domain d1kigh_: 1kig H:

Lineage for d1kigh_ (1kig H:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins)

6. Protein Coagulation factor Xa, protease domain [50574] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50576] (1 PDB entry)

8. Domain d1kigh_: 1kig H: [26346]
   Other proteins in same PDB: d1kigi_, d1kigl_

Details for d1kigh_

PDB Entry: 1kig, 3 Å

PDB Description: bovine factor xa

SCOP Domain Sequences for d1kigh_:

Sequence; same for both SEQRES and ATOM records:

>d1kigh_ b.47.1.2 (H:) Coagulation factor Xa, protease domain {Cow (Bos taurus)}
ivggrdcaegecpwqallvneenegfcggtilnefyvltaahclhqakrftvrvgdrnte
qeegnemahevemtvkhsrfvketydfdiavlrlktpirfrrnvapaclpekdwaeatlm
tqktgivsgfgrthekgrlsstlkmlevpyvdrstcklsssftitpnmfcagydtqpeda
cqgdsggphvtrfkdtyfvtgivswgegcarkgkfgvytkvsnflkwidkimkaragaag
s

Timeline for d1kigh_:

• d1kigh_ first appeared (with stable ids) in SCOP 1.55
  
• d1kigh_ appears in SCOP 1.65
  
• d1kigh_ appears in SCOP 1.69
  
• d1kigh_ appears in the current release, SCOPe 2.08