![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins) |
![]() | Protein Coagulation factor Xa, protease domain [50574] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [50576] (1 PDB entry) |
![]() | Domain d1kigh_: 1kig H: [26346] Other proteins in same PDB: d1kigi_, d1kigl_ |
PDB Entry: 1kig (more details), 3 Å
SCOP Domain Sequences for d1kigh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kigh_ b.47.1.2 (H:) Coagulation factor Xa, protease domain {Cow (Bos taurus)} ivggrdcaegecpwqallvneenegfcggtilnefyvltaahclhqakrftvrvgdrnte qeegnemahevemtvkhsrfvketydfdiavlrlktpirfrrnvapaclpekdwaeatlm tqktgivsgfgrthekgrlsstlkmlevpyvdrstcklsssftitpnmfcagydtqpeda cqgdsggphvtrfkdtyfvtgivswgegcarkgkfgvytkvsnflkwidkimkaragaag s
Timeline for d1kigh_: