Lineage for d1kigh_ (1kig H:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15009Protein Coagulation factor Xa (Chrismas factor), protease domain [50574] (2 species)
  7. 15010Species Cow (Bos taurus) [TaxId:9913] [50576] (1 PDB entry)
  8. 15011Domain d1kigh_: 1kig H: [26346]
    Other proteins in same PDB: d1kigi_, d1kigl_

Details for d1kigh_

PDB Entry: 1kig (more details), 3 Å

PDB Description: bovine factor xa

SCOP Domain Sequences for d1kigh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kigh_ b.47.1.2 (H:) Coagulation factor Xa (Chrismas factor), protease domain {Cow (Bos taurus)}
ivggrdcaegecpwqallvneenegfcggtilnefyvltaahclhqakrftvrvgdrnte
qeegnemahevemtvkhsrfvketydfdiavlrlktpirfrrnvapaclpekdwaeatlm
tqktgivsgfgrthekgrlsstlkmlevpyvdrstcklsssftitpnmfcagydtqpeda
cqgdsggphvtrfkdtyfvtgivswgegcarkgkfgvytkvsnflkwidkimkaragaag
s

SCOP Domain Coordinates for d1kigh_:

Click to download the PDB-style file with coordinates for d1kigh_.
(The format of our PDB-style files is described here.)

Timeline for d1kigh_: