SCOPe 2.07: Domain d4p7ib3: 4p7i B:215-312

Lineage for d4p7ib3 (4p7i B:215-312)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [232271] (6 PDB entries)

8. Domain d4p7ib3: 4p7i B:215-312 [263444]
   Other proteins in same PDB: d4p7ia1, d4p7ia2, d4p7ib1, d4p7ib2
   automated match to d1h4ra2
   complexed with gol

Details for d4p7ib3

PDB Entry: 4p7i, 2.6 Å

PDB Description: crystal structure of the merlin ferm/dcaf1 complex

PDB Compounds: (B:) merlin

SCOPe Domain Sequences for d4p7ib3:

Sequence; same for both SEQRES and ATOM records:

>d4p7ib3 b.55.1.0 (B:215-312) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
emygvnyftirnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik
pldkkidvfkfnssklrvnklilqlcignhdlfmrrrk

Timeline for d4p7ib3:

• d4p7ib3 first appeared in SCOPe 2.05
  
• d4p7ib3 appears in SCOPe 2.06
  
• d4p7ib3 appears in the current release, SCOPe 2.08