Lineage for d4p7ib2 (4p7i B:104-214)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310789Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2310832Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 2310908Family a.11.2.0: automated matches [254193] (1 protein)
    not a true family
  6. 2310909Protein automated matches [254423] (5 species)
    not a true protein
  7. 2310986Species Mouse (Mus musculus) [TaxId:10090] [255101] (5 PDB entries)
  8. 2311001Domain d4p7ib2: 4p7i B:104-214 [263443]
    Other proteins in same PDB: d4p7ia1, d4p7ia3, d4p7ib1, d4p7ib3
    automated match to d1h4ra1
    complexed with gol

Details for d4p7ib2

PDB Entry: 4p7i (more details), 2.6 Å

PDB Description: crystal structure of the merlin ferm/dcaf1 complex
PDB Compounds: (B:) merlin

SCOPe Domain Sequences for d4p7ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p7ib2 a.11.2.0 (B:104-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
naeeelvqeitqhlfflqvkkqildekvycppeasvllasyavqakygdydpsvhkrgfl
aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl

SCOPe Domain Coordinates for d4p7ib2:

Click to download the PDB-style file with coordinates for d4p7ib2.
(The format of our PDB-style files is described here.)

Timeline for d4p7ib2: