Lineage for d4ow1u_ (4ow1 U:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1887016Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1887017Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1888916Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 1888917Protein automated matches [190563] (12 species)
    not a true protein
  7. 1888940Species Mycobacterium tuberculosis [TaxId:1773] [236519] (2 PDB entries)
  8. 1888946Domain d4ow1u_: 4ow1 U: [263358]
    automated match to d4ow1a_
    complexed with edo

Details for d4ow1u_

PDB Entry: 4ow1 (more details), 1.9 Å

PDB Description: crystal structure of resuscitation promoting factor c
PDB Compounds: (U:) Resuscitation-promoting factor RpfC

SCOPe Domain Sequences for d4ow1u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ow1u_ d.2.1.0 (U:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
pspnwdavaqcesggnwaantgngkygglqfkpatwaafggvgnpaaasreqqiavanrv
laeqgldawptcgaasglpialwsk

SCOPe Domain Coordinates for d4ow1u_:

Click to download the PDB-style file with coordinates for d4ow1u_.
(The format of our PDB-style files is described here.)

Timeline for d4ow1u_: