SCOPe 2.07: Domain d4nrrb1: 4nrr B:-1-411

Lineage for d4nrrb1 (4nrr B:-1-411)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (125 species)
   not a true protein

7. Species Rhizomucor miehei [TaxId:4839] [256971] (7 PDB entries)

8. Domain d4nrrb1: 4nrr B:-1-411 [263214]
   Other proteins in same PDB: d4nrra2, d4nrrb2
   automated match to d4nrra_
   complexed with bma, fru; mutant

Details for d4nrrb1

PDB Entry: 4nrr, 2.4 Å

PDB Description: crystal structure of glycoside hydrolase family 5 mannosidase (e202a mutant) from rhizomucor miehei in complex with mannosyl-fructose

PDB Compounds: (B:) Exo-beta-1,4-mannosidase

SCOPe Domain Sequences for d4nrrb1:

Sequence; same for both SEQRES and ATOM records:

>d4nrrb1 c.1.8.0 (B:-1-411) automated matches {Rhizomucor miehei [TaxId: 4839]}
efafvkiasdgkgftrygepylirganywqgmnlgaddcsggdrkrmeleikqmaemgin
nlrvmassegpddqpyrmrpsmmpqpgkynegvfvgldylldtmdrynmtavmtlgnfwq
wsggfgqyvawitgnqtipypvgdvtydeftqfaarfyndseiapkanklfkdhiytvqn
rrntvngkiykedpvimswqianapqeapaswfeeistfikkgapkhlvsagleskldey
dfdrahdhknidyttchcwvenwgiydpadpdglphaneymhdflesrskwaaqlnkpiv
meefgmardawrnpedetykylpstptshkdeyyqkafnqivslasnrsfsgsnfwaygg
egrstyppnpygmvwlgdpphephgwysvysndttvqiikdynanllkvqkel

Timeline for d4nrrb1:

• d4nrrb1 first appeared in SCOPe 2.05, called d4nrrb_
  
• d4nrrb1 appears in SCOPe 2.06
  
• d4nrrb1 appears in the current release, SCOPe 2.08