SCOPe 2.05: Domain d4nrrb_: 4nrr B:

Lineage for d4nrrb_ (4nrr B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (72 species)
   not a true protein

7. Species Rhizomucor miehei [TaxId:4839] [256971] (6 PDB entries)

8. Domain d4nrrb_: 4nrr B: [263214]
   automated match to d4nrra_
   mutant

Details for d4nrrb_

PDB Entry: 4nrr, 2.4 Å

PDB Description: crystal structure of glycoside hydrolase family 5 mannosidase (e202a mutant) from rhizomucor miehei in complex with mannosyl-fructose

PDB Compounds: (B:) Exo-beta-1,4-mannosidase

SCOPe Domain Sequences for d4nrrb_:

Sequence; same for both SEQRES and ATOM records:

>d4nrrb_ c.1.8.0 (B:) automated matches {Rhizomucor miehei [TaxId: 4839]}
gsefafvkiasdgkgftrygepylirganywqgmnlgaddcsggdrkrmeleikqmaemg
innlrvmassegpddqpyrmrpsmmpqpgkynegvfvgldylldtmdrynmtavmtlgnf
wqwsggfgqyvawitgnqtipypvgdvtydeftqfaarfyndseiapkanklfkdhiytv
qnrrntvngkiykedpvimswqianapqeapaswfeeistfikkgapkhlvsagleskld
eydfdrahdhknidyttchcwvenwgiydpadpdglphaneymhdflesrskwaaqlnkp
ivmeefgmardawrnpedetykylpstptshkdeyyqkafnqivslasnrsfsgsnfway
ggegrstyppnpygmvwlgdpphephgwysvysndttvqiikdynanllkvqkel

Timeline for d4nrrb_:

• d4nrrb_ is new in SCOPe 2.05-stable
  
• d4nrrb_ is called d4nrrb1 in SCOPe 2.06
  
• d4nrrb_ appears in the current release, SCOPe 2.08, called d4nrrb1