SCOPe 2.06: Domain d4lllj_: 4lll J:

Lineage for d4lllj_ (4lll J:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [193082] (9 PDB entries)

8. Domain d4lllj_: 4lll J: [262956]
   automated match to d4llla_
   protein/DNA complex

Details for d4lllj_

PDB Entry: 4lll, 3.04 Å

PDB Description: crystal structure of s. aureus mepr-dna complex

PDB Compounds: (J:) MepR

SCOPe Domain Sequences for d4lllj_:

Sequence; same for both SEQRES and ATOM records:

>d4lllj_ a.4.5.0 (J:) automated matches {Staphylococcus aureus [TaxId: 1280]}
eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg
ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlse
eeneqmkanltkmlsslq

Timeline for d4lllj_:

• d4lllj_ first appeared in SCOPe 2.05
  
• d4lllj_ appears in SCOPe 2.07
  
• d4lllj_ appears in the current release, SCOPe 2.08