Lineage for d4kv5j_ (4kv5 J:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2034177Domain d4kv5j_: 4kv5 J: [262879]
    Other proteins in same PDB: d4kv5a_, d4kv5b_, d4kv5c_, d4kv5d_, d4kv5f2, d4kv5i2, d4kv5k2, d4kv5l2
    automated match to d4kv5e_

Details for d4kv5j_

PDB Entry: 4kv5 (more details), 3 Å

PDB Description: scfv gc1009 in complex with tgf-beta1.
PDB Compounds: (J:) heavy chain GC1009 scFv

SCOPe Domain Sequences for d4kv5j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kv5j_ b.1.1.0 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgssvkvsckasgytfssnviswvrqapgqglewmggvipivdiany
aqrfkgrvtitadeststtymelsslrsedtavyycastlglvldamdywgqgtlvtvss

SCOPe Domain Coordinates for d4kv5j_:

Click to download the PDB-style file with coordinates for d4kv5j_.
(The format of our PDB-style files is described here.)

Timeline for d4kv5j_: