Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein AMPC beta-Lactamase, class C [56618] (4 species) contains small alpha+beta subdomain inserted in the common fold |
Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (115 PDB entries) |
Domain d4kg6d_: 4kg6 D: [262824] automated match to d3ixda_ complexed with po4; mutant |
PDB Entry: 4kg6 (more details), 1.75 Å
SCOPe Domain Sequences for d4kg6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kg6d_ e.3.1.1 (D:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]} apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd evksssdllrfyqnwqpawapgtqrlyagssiglfgalavkpsglsfeqamqtrvfqplk lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
Timeline for d4kg6d_: