SCOPe 2.05: Domain d2este_: 2est E:

Lineage for d2este_ (2est E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (117 PDB entries)

8. Domain d2este_: 2est E: [26279]
   complexed with 2z5, so4

Details for d2este_

PDB Entry: 2est, 2.5 Å

PDB Description: Crystallographic study of the binding of a trifluoroacetyl dipeptide anilide inhibitor with elastase

PDB Compounds: (E:) elastase

SCOPe Domain Sequences for d2este_:

Sequence; same for both SEQRES and ATOM records:

>d2este_ b.47.1.2 (E:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d2este_:

• d2este_ first appeared (with stable ids) in SCOP 1.55
  
• d2este_ appears in SCOPe 2.04
  
• d2este_ appears in SCOPe 2.06
  
• d2este_ appears in the current release, SCOPe 2.08