Lineage for d3bnwa1 (3bnw A:1-171)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403385Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families) (S)
  5. 2403428Family b.43.5.0: automated matches [227257] (1 protein)
    not a true family
  6. 2403429Protein automated matches [227042] (2 species)
    not a true protein
  7. 2403434Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [255763] (1 PDB entry)
  8. 2403435Domain d3bnwa1: 3bnw A:1-171 [262264]
    Other proteins in same PDB: d3bnwa2
    automated match to d3bnwb_

Details for d3bnwa1

PDB Entry: 3bnw (more details), 2.4 Å

PDB Description: Crystal structure of riboflavin kinase from Trypanosoma brucei
PDB Compounds: (A:) Riboflavin kinase, putative

SCOPe Domain Sequences for d3bnwa1:

Sequence, based on SEQRES records: (download)

>d3bnwa1 b.43.5.0 (A:1-171) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mrqtgsfqpfflrgkvvhgkgrggsqlgfptanigldkdvmeclqpyknlvvygwgtvsq
vpgkeresfgpypfaasigfnmqfdektltvepyflhefgwdfygavvkiivlgeirsmg
sfhslqalvdtiksdvqftrdmlqkpqlqefsrhslfespsstipyfedlp

Sequence, based on observed residues (ATOM records): (download)

>d3bnwa1 b.43.5.0 (A:1-171) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mrqtgsfqpfflrgkvvhsqlgfptanigldkdvmeclqpyknlvvygwgtvsqvpgker
esfgpypfaasigfntltvepyflhefgwdfygavvkiivlgeirsmgsfhslqalvdti
ksdvqftrdmlqkpqlqefsrhslfespsstipyfedlp

SCOPe Domain Coordinates for d3bnwa1:

Click to download the PDB-style file with coordinates for d3bnwa1.
(The format of our PDB-style files is described here.)

Timeline for d3bnwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bnwa2
View in 3D
Domains from other chains:
(mouse over for more information)
d3bnwb_