SCOPe 2.08: Domain d3bnwa1: 3bnw A:1-171

Lineage for d3bnwa1 (3bnw A:1-171)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families)

5. Family b.43.5.0: automated matches [227257] (1 protein)
   not a true family

6. Protein automated matches [227042] (2 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [255763] (1 PDB entry)

8. Domain d3bnwa1: 3bnw A:1-171 [262264]
   Other proteins in same PDB: d3bnwa2
   automated match to d3bnwb_

Details for d3bnwa1

PDB Entry: 3bnw, 2.4 Å

PDB Description: Crystal structure of riboflavin kinase from Trypanosoma brucei

PDB Compounds: (A:) Riboflavin kinase, putative

SCOPe Domain Sequences for d3bnwa1:

Sequence, based on SEQRES records:

>d3bnwa1 b.43.5.0 (A:1-171) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mrqtgsfqpfflrgkvvhgkgrggsqlgfptanigldkdvmeclqpyknlvvygwgtvsq
vpgkeresfgpypfaasigfnmqfdektltvepyflhefgwdfygavvkiivlgeirsmg
sfhslqalvdtiksdvqftrdmlqkpqlqefsrhslfespsstipyfedlp

Sequence, based on observed residues (ATOM records):

>d3bnwa1 b.43.5.0 (A:1-171) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mrqtgsfqpfflrgkvvhsqlgfptanigldkdvmeclqpyknlvvygwgtvsqvpgker
esfgpypfaasigfntltvepyflhefgwdfygavvkiivlgeirsmgsfhslqalvdti
ksdvqftrdmlqkpqlqefsrhslfespsstipyfedlp

Timeline for d3bnwa1:

• d3bnwa1 first appeared in SCOPe 2.05, called d3bnwa_
  
• d3bnwa1 appears in SCOPe 2.07