![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
![]() | Protein automated matches [190115] (91 species) not a true protein |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [262022] (2 PDB entries) |
![]() | Domain d4ur7c1: 4ur7 C:1-303 [262032] Other proteins in same PDB: d4ur7b2, d4ur7c2 automated match to d3pb2a_ complexed with fmt, gol |
PDB Entry: 4ur7 (more details), 1.5 Å
SCOPe Domain Sequences for d4ur7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ur7c1 c.1.10.0 (C:1-303) automated matches {Agrobacterium tumefaciens [TaxId: 358]} mdpeqiktalgsgllsfpvthfdaegrfaadsyrehvewlagykapvlfaaggtgeffsl kpdeiptivaaakevagetaivsgcgygteiavdiarsvekvgadgilllphylidapqe glyahikkvcqsvgigvmvynrdnsvlqadtlarlcdecpnlvgfxdgtgdiglvrqita kmgdrlmylggmptaelfaeaylgagfttyssavfnfvpglanefyaalrageratceri lvdffypfmairnrakgyavsavkagvrlqgfnagpvraplkdltneeigmlealigthk rka
Timeline for d4ur7c1:
![]() Domains from other chains: (mouse over for more information) d4ur7a_, d4ur7b1, d4ur7b2, d4ur7d_ |