SCOPe 2.06: Domain d1hdt.1: 1hdt L:,H:

Lineage for d1hdt.1 (1hdt L:,H:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50532] (170 PDB entries)
   Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620

8. Domain d1hdt.1: 1hdt L:,H: [26183]
   complexed with 0e7

Details for d1hdt.1

PDB Entry: 1hdt, 2.6 Å

PDB Description: structure of a retro-binding peptide inhibitor complexed with human alpha-thrombin

PDB Compounds: (H:) alpha-thrombin, (L:) alpha-thrombin

SCOPe Domain Sequences for d1hdt.1:

Sequence; same for both SEQRES and ATOM records:

>g1hdt.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
sgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrkspqel
lcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyi
hprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlke
twtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsg
gpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

Timeline for d1hdt.1:

• d1hdt.1 first appeared (with stable ids) in SCOP 1.55
  
• d1hdt.1 appears in SCOPe 2.05
  
• d1hdt.1 appears in SCOPe 2.07
  
• d1hdt.1 appears in the current release, SCOPe 2.08