![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
![]() | Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
![]() | Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
![]() | Protein Lactate dehydrogenase [56339] (20 species) |
![]() | Species Cryptosporidium parvum [TaxId:5807] [225186] (10 PDB entries) |
![]() | Domain d4nd5d2: 4nd5 D:165-327 [261805] Other proteins in same PDB: d4nd5a1, d4nd5b1, d4nd5c1, d4nd5d1 automated match to d2ewda2 |
PDB Entry: 4nd5 (more details), 2.1 Å
SCOPe Domain Sequences for d4nd5d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nd5d2 d.162.1.1 (D:165-327) Lactate dehydrogenase {Cryptosporidium parvum [TaxId: 5807]} gvldssrfrtfiaqhfgvnasdvsanvigghgdgmvpatssvsvggvplssfikqglitq eqideivchtriawkevadnlktgtayfapaaaavkmaeaylkdkkavvpcsafcsnhyg vkgiymgvptiigkngvedileldltpleqkllgesinevntisk
Timeline for d4nd5d2: