SCOPe 2.04: Domain d4nd5d2: 4nd5 D:165-327

Lineage for d4nd5d2 (4nd5 D:165-327)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (8 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:353152] [261800] (5 PDB entries)

8. Domain d4nd5d2: 4nd5 D:165-327 [261805]
   Other proteins in same PDB: d4nd5a1, d4nd5b1, d4nd5c1, d4nd5d1
   automated match to d2ewda2

Details for d4nd5d2

PDB Entry: 4nd5, 2.1 Å

PDB Description: crystal structure of the lactate dehydrogenase from cryptosporidium parvum

PDB Compounds: (D:) Lactate dehydrogenase, adjacent gene encodes predicted malate dehydrogenase

SCOPe Domain Sequences for d4nd5d2:

Sequence; same for both SEQRES and ATOM records:

>d4nd5d2 d.162.1.1 (D:165-327) automated matches {Cryptosporidium parvum [TaxId: 353152]}
gvldssrfrtfiaqhfgvnasdvsanvigghgdgmvpatssvsvggvplssfikqglitq
eqideivchtriawkevadnlktgtayfapaaaavkmaeaylkdkkavvpcsafcsnhyg
vkgiymgvptiigkngvedileldltpleqkllgesinevntisk

Timeline for d4nd5d2:

• d4nd5d2 is new in SCOPe 2.04-stable
  
• d4nd5d2 appears in SCOPe 2.05
  
• d4nd5d2 appears in the current release, SCOPe 2.08