SCOPe 2.06: Domain d4ruub_: 4ruu B:

Lineage for d4ruub_ (4ruu B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (57 PDB entries)

8. Domain d4ruub_: 4ruu B: [261582]
   automated match to d4exza_
   complexed with act, ret; mutant

Details for d4ruub_

PDB Entry: 4ruu, 1.4 Å

PDB Description: crystal structure of the q108k:k40l mutant of human cellular retinol binding proteinii in complex with all-trans-retinal after 24 hour incubation at 1.4 angstrom resolution

PDB Compounds: (B:) Retinol-binding protein 2

SCOPe Domain Sequences for d4ruub_:

Sequence; same for both SEQRES and ATOM records:

>d4ruub_ b.60.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trdqngtwemesnenfegymkaldidfatrkiavrltqtlvidqdgdnfktkttstfrny
dvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkkwiegdklylelt
cgdqvcrqvfkkk

Timeline for d4ruub_:

• d4ruub_ first appeared in SCOPe 2.04
  
• d4ruub_ appears in SCOPe 2.05
  
• d4ruub_ appears in SCOPe 2.07
  
• d4ruub_ appears in the current release, SCOPe 2.08